| Identification |
|---|
| HMDB Protein ID
| CDBP05310 |
| Secondary Accession Numbers
| Not Available |
| Name
| Procollagen galactosyltransferase 2 |
| Description
| Not Available |
| Synonyms
|
- Glycosyltransferase 25 family member 2
- Hydroxylysine galactosyltransferase 2
|
| Gene Name
| GLT25D2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Has a beta-galactosyltransferase activity; transfers beta-galactose to hydroxylysine residues on collagen.
|
| GO Classification
|
| Biological Process |
| extracellular matrix organization |
| lipopolysaccharide biosynthetic process |
| Cellular Component |
| endoplasmic reticulum lumen |
| Molecular Function |
| procollagen galactosyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Other types of O-glycan biosynthesis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 1 |
| Locus
| 1q25 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 72923.665 |
| Theoretical pI
| 6.199 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|16506820|ref|NP_055916.1| procollagen galactosyltransferase 2 precursor [Homo sapiens]
MAARPAATLAWSLLLLSSALLREGCRARFVAERDSEDDGEEPVVFPESPLQSPTVLVAVL
ARNAAHTLPH
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8IYK4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:16790 |
| References |
|---|
| General References
| Not Available |