| Identification |
|---|
| HMDB Protein ID
| CDBP05307 |
| Secondary Accession Numbers
| Not Available |
| Name
| Glutathione S-transferase theta-2B |
| Description
| Not Available |
| Synonyms
|
- GST class-theta-2
- Glutathione S-transferase theta-2
|
| Gene Name
| GSTT2B |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a sulfatase activity.
|
| GO Classification
|
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| glutathione transferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Metabolism of xenobiotics by cytochrome P450 | Not Available |  | | Drug metabolism - cytochrome P450 | Not Available |  | | Chemical carcinogenesis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 22 |
| Locus
| 22q11.23 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 27506.715 |
| Theoretical pI
| 6.406 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|4504187|ref|NP_000845.1| glutathione S-transferase theta-2 [Homo sapiens]
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG
DFILTESSAI
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P0CG30 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:33437 |
| References |
|---|
| General References
| Not Available |