| Identification |
|---|
| HMDB Protein ID
| CDBP05306 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable glutathione peroxidase 8 |
| Description
| Not Available |
| Synonyms
|
- GPx-8
- GSHPx-8
|
| Gene Name
| GPX8 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Not Available |
| GO Classification
|
| Biological Process |
| response to oxidative stress |
| Cellular Component |
| integral to membrane |
| Molecular Function |
| glutathione peroxidase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5q11.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 23880.83 |
| Theoretical pI
| 9.353 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|192455698|ref|NP_001008398.2| probable glutathione peroxidase 8 [Homo sapiens]
MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTV
SLEKYKGKVS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8TED1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:33100 |
| References |
|---|
| General References
| Not Available |