| Identification |
| HMDB Protein ID
| CDBP05303 |
| Secondary Accession Numbers
| Not Available |
| Name
| N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform A |
| Description
| Not Available |
| Synonyms
|
- N-acetylglucosaminyltransferase
- I-branching enzyme
- IGNT
|
| Gene Name
| GCNT2 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Branching enzyme that converts linear into branched poly-N-acetyllactosaminoglycans. Introduces the blood group I antigen during embryonic development. It is closely associated with the development and maturation of erythroid cells. The expression of the blood group I antigen in erythrocytes is determined by isoform C.
|
| GO Classification
|
| Biological Process |
| protein glycosylation |
| Cellular Component |
| Golgi membrane |
| integral to membrane |
| Molecular Function |
| N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein glycosylation | Not Available | Not Available | | Glycosphingolipid biosynthesis - lacto and neolacto series | Not Available |  |
|
| Gene Properties |
| Chromosome Location
| 6 |
| Locus
| 6p24.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 45873.115 |
| Theoretical pI
| 7.181 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|21717810|ref|NP_663624.1| N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase isoform A [Homo sapiens]
MMGSWKHCLFSASLISALIFVFVYNTELWENKRFLRAALSNASLLAEACHQIFEGKVFYP
TENALKTTLD
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8N0V5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:4204 |
| References |
| General References
| Not Available |