| Identification |
| HMDB Protein ID
| CDBP05302 |
| Secondary Accession Numbers
| Not Available |
| Name
| Glycerol-3-phosphate transporter |
| Description
| Not Available |
| Synonyms
|
- G-3-P transporter
- Glycerol-3-phosphate permease
- Solute carrier family 37 member 1
- G-3-P permease
|
| Gene Name
| SLC37A1 |
| Protein Type
| Transporter |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Not Available |
| GO Classification
|
| Biological Process |
| carbohydrate transport |
| transmembrane transport |
| Cellular Component |
| integral to membrane |
| Molecular Function |
| transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 21 |
| Locus
| 21q22.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 57647.52 |
| Theoretical pI
| 8.31 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|49619231|ref|NP_061837.3| glycerol-3-phosphate transporter [Homo sapiens]
MARLPAGIRFIISFSRDQWYRAFIFILTFLLYASFHLSRKPISIVKGELHKYCTAWDEAD
VRFSSQNRKS
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P57057 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11024 |
| References |
| General References
| Not Available |