| Identification |
|---|
| HMDB Protein ID
| CDBP05301 |
| Secondary Accession Numbers
| Not Available |
| Name
| Poly(A) RNA polymerase GLD2 |
| Description
| Not Available |
| Synonyms
|
- hGLD-2
- PAP-associated domain-containing protein 4
- Terminal uridylyltransferase 2
- TUTase 2
|
| Gene Name
| PAPD4 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Cytoplasmic poly(A) RNA polymerase that adds successive AMP monomers to the 3'-end of specific RNAs, forming a poly(A) tail. In contrast to the canonical nuclear poly(A) RNA polymerase, it only adds poly(A) to selected cytoplasmic mRNAs. Does not play a role in replication-dependent histone mRNA degradation.
|
| GO Classification
|
| Biological Process |
| histone mRNA catabolic process |
| mRNA processing |
| RNA polyadenylation |
| Cellular Component |
| cytoplasm |
| nuclear RNA-directed RNA polymerase complex |
| Molecular Function |
| metal ion binding |
| ATP binding |
| polynucleotide adenylyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5q14.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 56027.175 |
| Theoretical pI
| 9.375 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|167555097|ref|NP_001107865.1| poly(A) RNA polymerase GLD2 [Homo sapiens]
MFPNSILGRPPFTPNHQQHNNFFTLSPTVYSHQQLIDAQFNFQNADLSRAVSLQQLTYGN
VSPIQTSASP
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q6PIY7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26776 |
| References |
|---|
| General References
| Not Available |