| Identification |
|---|
| HMDB Protein ID
| CDBP05298 |
| Secondary Accession Numbers
| Not Available |
| Name
| Gamma-glutamylaminecyclotransferase |
| Description
| Not Available |
| Synonyms
|
- GGACT
- AIG2-like domain-containing protein 1
- Gamma-glutamylamine cyclotransferase
|
| Gene Name
| GGACT |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Contributes to degradation of proteins cross-linked by transglutaminases. Degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. Catalyzes the formation of 5-oxoproline from L-gamma-glutamyl-L-epsilon-lysine. Inactive with L-gamma-glutamyl-alpha-amino acid substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine.
|
| GO Classification
|
| Biological Process |
| cellular modified amino acid catabolic process |
| Molecular Function |
| gamma-glutamylcyclotransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 13 |
| Locus
| 13q32.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 17328.44 |
| Theoretical pI
| 6.88 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|304284846|ref|NP_001182016.1| gamma-glutamylaminecyclotransferase [Homo sapiens]
MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSG
RLVEGEVYAV
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9BVM4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25100 |
| References |
|---|
| General References
| Not Available |