| Identification |
|---|
| HMDB Protein ID
| CDBP05295 |
| Secondary Accession Numbers
| Not Available |
| Name
| Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 |
| Description
| Not Available |
| Synonyms
|
- C2GnT-mucin type
- Core 2/core 4 beta-1,6-N-acetylglucosaminyltransferase
- C2GnT-M
- hC2GnT-M
- C2/4GnT
|
| Gene Name
| GCNT3 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Glycosyltransferase that can synthesize all known mucin beta 6 N-acetylglucosaminides. Mediates core 2 and core 4 O-glycan branching, 2 important steps in mucin-type biosynthesis. Has also I-branching enzyme activity by converting linear into branched poly-N-acetyllactosaminoglycans, leading to introduce the blood group I antigen during embryonic development.
|
| GO Classification
|
| Biological Process |
| O-glycan processing |
| post-translational protein modification |
| intestinal absorption |
| kidney morphogenesis |
| tissue morphogenesis |
| immunoglobulin production in mucosal tissue |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity |
| acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity |
| N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein glycosylation | Not Available | Not Available | | Mucin type O-Glycan biosynthesis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 15 |
| Locus
| 15q21.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 50863.175 |
| Theoretical pI
| 8.252 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|4758422|ref|NP_004742.1| beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 [Homo sapiens]
MVQWKRLCQLHYLWALGCYMLLATVALKLSFRLKCDSDHLGLESRESQSQYCRNILYNFL
KLPAKRSINC
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O95395 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:4205 |
| References |
|---|
| General References
| Not Available |