| Identification |
| HMDB Protein ID
| CDBP05294 |
| Secondary Accession Numbers
| Not Available |
| Name
| Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase |
| Description
| Not Available |
| Synonyms
|
- Core 2-branching enzyme
- Core2-GlcNAc-transferase
- C2GNT
- Core 2 GNT
|
| Gene Name
| GCNT1 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Forms critical branches in O-glycans.
|
| GO Classification
|
| Biological Process |
| O-glycan processing |
| response to insulin stimulus |
| post-translational protein modification |
| kidney morphogenesis |
| tissue morphogenesis |
| Cellular Component |
| extracellular space |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein glycosylation | Not Available | Not Available | | Mucin type O-Glycan biosynthesis | Not Available |  |
|
| Gene Properties |
| Chromosome Location
| 9 |
| Locus
| 9q13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 49798.425 |
| Theoretical pI
| 8.418 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|148277029|ref|NP_001091102.1| beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase [Homo sapiens]
MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEFVSVRHLELAGENPSSDINCT
KVLQGDVNEI
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q02742 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:4203 |
| References |
| General References
| Not Available |