| Identification |
|---|
| HMDB Protein ID
| CDBP05293 |
| Secondary Accession Numbers
| Not Available |
| Name
| Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial |
| Description
| Not Available |
| Synonyms
|
- Glu-AdT subunit C
- Protein 15E1.2
|
| Gene Name
| GATC |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
|
| GO Classification
|
| Biological Process |
| glutaminyl-tRNAGln biosynthesis via transamidation |
| mitochondrial translation |
| regulation of translational fidelity |
| Cellular Component |
| mitochondrion |
| glutamyl-tRNA(Gln) amidotransferase complex |
| Molecular Function |
| ATP binding |
| glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 12 |
| Locus
| 12q24.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 15085.885 |
| Theoretical pI
| 5.041 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|50978624|ref|NP_789788.1| glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial [Homo sapiens]
MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKA
IAFADRLRAV
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O43716 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25068 |
| References |
|---|
| General References
| Not Available |