| Identification |
|---|
| HMDB Protein ID
| CDBP05291 |
| Secondary Accession Numbers
| Not Available |
| Name
| Galactoside 3(4)-L-fucosyltransferase |
| Description
| Not Available |
| Synonyms
|
- Blood group Lewis alpha-4-fucosyltransferase
- Fucosyltransferase 3
- Fucosyltransferase III
- Lewis FT
- FucT-III
|
| Gene Name
| FUT3 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| May catalyze alpha-1,3 and alpha-1,4 glycosidic linkages involved in the expression of Vim-2, Lewis A, Lewis B, sialyl Lewis X and Lewis X/SSEA-1 antigens. May be involved in blood group Lewis determination; Lewis-positive (Le(+)) individuals have an active enzyme while Lewis-negative (Le(-)) individuals have an inactive enzyme. Also acts on the corresponding 1,4-galactosyl derivative, forming 1,3-L-fucosyl links.
|
| GO Classification
|
| Biological Process |
| oligosaccharide biosynthetic process |
| cell-cell recognition |
| macromolecule glycosylation |
| protein glycosylation |
| Cellular Component |
| Golgi cisterna membrane |
| membrane |
| integral to membrane |
| Molecular Function |
| 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity |
| alpha-(1->3)-fucosyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein glycosylation | Not Available | Not Available | | Glycosphingolipid biosynthesis - lacto and neolacto series | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 19 |
| Locus
| 19p13.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 42116.69 |
| Theoretical pI
| 9.006 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|4503809|ref|NP_000140.1| galactoside 3(4)-L-fucosyltransferase [Homo sapiens]
MDPLGAAKPQWPWRRCLAALLFQLLVAVCFFSYLRVSRDDATGSPRAPSGSSRQDTTPTR
PTLLILLWTW
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P21217 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:4014 |
| References |
|---|
| General References
| Not Available |