| Identification |
|---|
| HMDB Protein ID
| CDBP05283 |
| Secondary Accession Numbers
| Not Available |
| Name
| EGF domain-specific O-linked N-acetylglucosamine transferase |
| Description
| Not Available |
| Synonyms
|
- Extracellular O-linked N-acetylglucosamine transferase
|
| Gene Name
| EOGT |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in extracellular proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc). Specifically glycosylates the Thr residue located between the fifth and sixth conserved cysteines of folded EGF-like domains (By similarity).
|
| GO Classification
|
| Biological Process |
| protein O-linked glycosylation |
| Cellular Component |
| endoplasmic reticulum lumen |
| Molecular Function |
| protein N-acetylglucosaminyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 3 |
| Locus
| 3p14.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 52296.26 |
| Theoretical pI
| 6.818 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|39930531|ref|NP_775925.1| EGF domain-specific O-linked N-acetylglucosamine transferase precursor [Homo sapiens]
MLMLFVFGVLLHEVSLSGQNEAPPNTHSIPGEPLYNYASIRLPEEHIPFFLHNNRHIATV
CRKDSLCPYK
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q5NDL2 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:28526 |
| References |
|---|
| General References
| Not Available |