Showing Protein EGF domain-specific O-linked N-acetylglucosamine transferase (CDBP05283)
| Identification | |||||||
|---|---|---|---|---|---|---|---|
| HMDB Protein ID | CDBP05283 | ||||||
| Secondary Accession Numbers | Not Available | ||||||
| Name | EGF domain-specific O-linked N-acetylglucosamine transferase | ||||||
| Description | Not Available | ||||||
| Synonyms |
|
||||||
| Gene Name | EOGT | ||||||
| Protein Type | Enzyme | ||||||
| Biological Properties | |||||||
| General Function | Not Available | ||||||
| Specific Function | Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in extracellular proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc). Specifically glycosylates the Thr residue located between the fifth and sixth conserved cysteines of folded EGF-like domains (By similarity). | ||||||
| GO Classification |
|
||||||
| Cellular Location | Not Available | ||||||
| Pathways | Not Available | ||||||
| Gene Properties | |||||||
| Chromosome Location | 3 | ||||||
| Locus | 3p14.1 | ||||||
| SNPs | Not Available | ||||||
| Gene Sequence | Not Available | ||||||
| Protein Properties | |||||||
| Number of Residues | Not Available | ||||||
| Molecular Weight | 52296.26 | ||||||
| Theoretical pI | 6.818 | ||||||
| Pfam Domain Function | Not Available | ||||||
| Signals | Not Available | ||||||
| Transmembrane Regions | Not Available | ||||||
| Protein Sequence |
>gi|39930531|ref|NP_775925.1| EGF domain-specific O-linked N-acetylglucosamine transferase precursor [Homo sapiens] MLMLFVFGVLLHEVSLSGQNEAPPNTHSIPGEPLYNYASIRLPEEHIPFFLHNNRHIATV CRKDSLCPYK |
||||||
| External Links | |||||||
| GenBank ID Protein | Not Available | ||||||
| UniProtKB/Swiss-Prot ID | Q5NDL2 | ||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
| PDB IDs | Not Available | ||||||
| GenBank Gene ID | Not Available | ||||||
| GeneCard ID | Not Available | ||||||
| GenAtlas ID | Not Available | ||||||
| HGNC ID | HGNC:28526 | ||||||
| References | |||||||
| General References | Not Available | ||||||