Identification |
HMDB Protein ID
| CDBP05280 |
Secondary Accession Numbers
| Not Available |
Name
| Elongation of very long chain fatty acids protein 5 |
Description
| Not Available |
Synonyms
|
- 3-keto acyl-CoA synthase ELOVL5
- ELOVL fatty acid elongase 5
- Fatty acid elongase 1
- Very-long-chain 3-oxoacyl-CoA synthase 5
- ELOVL FA elongase 5
- hELO1
|
Gene Name
| ELOVL5 |
Protein Type
| Enzyme |
Biological Properties |
General Function
| Not Available |
Specific Function
| Condensing enzyme that catalyzes the synthesis of monounsaturated and of polyunsaturated very long chain fatty acids Acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C18:3(n-6) acyl-CoA.
|
GO Classification
|
Biological Process |
linoleic acid metabolic process |
long-chain fatty-acyl-CoA biosynthetic process |
triglyceride biosynthetic process |
fatty acid elongation, monounsaturated fatty acid |
very long-chain fatty acid biosynthetic process |
fatty acid elongation, polyunsaturated fatty acid |
alpha-linolenic acid metabolic process |
Cellular Component |
endoplasmic reticulum membrane |
integral to membrane |
Molecular Function |
fatty acid elongase activity |
|
Cellular Location
|
Not Available
|
Pathways
|
Name | SMPDB/Pathwhiz | KEGG | Fatty acid elongation | Not Available |  | Biosynthesis of unsaturated fatty acids | Not Available |  | Alpha Linolenic Acid and Linoleic Acid Metabolism |    |  |
|
Gene Properties |
Chromosome Location
| 6 |
Locus
| 6p21.1-p12.1 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 38402.505 |
Theoretical pI
| 9.533 |
Pfam Domain Function
|
Not Available |
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>gi|338827646|ref|NP_001229757.1| elongation of very long chain fatty acids protein 5 isoform 2 [Homo sapiens]
MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFS
CRGILVVYNL
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| Q9NYP7 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
Not Available |
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:21308 |
References |
General References
| Not Available |