| Identification |
|---|
| HMDB Protein ID
| CDBP05279 |
| Secondary Accession Numbers
| Not Available |
| Name
| Elongation of very long chain fatty acids protein 3 |
| Description
| Not Available |
| Synonyms
|
- 3-keto acyl-CoA synthase ELOVL3
- Cold-inducible glycoprotein of 30 kDa
- ELOVL fatty acid elongase 3
- Very-long-chain 3-oxoacyl-CoA synthase 3
- ELOVL FA elongase 3
|
| Gene Name
| ELOVL3 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Condensing enzyme that elongates saturated and monounsaturated very long chain fatty acids (VLCFAs). Highest activity toward C18 acyl-CoAs, especially C18:0 acyl-CoAs.
|
| GO Classification
|
| Biological Process |
| long-chain fatty-acyl-CoA biosynthetic process |
| triglyceride biosynthetic process |
| fatty acid elongation, monounsaturated fatty acid |
| fatty acid elongation, saturated fatty acid |
| very long-chain fatty acid biosynthetic process |
| fatty acid elongation, polyunsaturated fatty acid |
| Cellular Component |
| endoplasmic reticulum membrane |
| integral to membrane |
| Molecular Function |
| transferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Fatty acid elongation | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 10 |
| Locus
| 10q24.32 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 31500.285 |
| Theoretical pI
| 9.513 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|23097310|ref|NP_689523.1| elongation of very long chain fatty acids protein 3 [Homo sapiens]
MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKG
FNLQGPLILW
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9HB03 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18047 |
| References |
|---|
| General References
| Not Available |