| Identification |
| HMDB Protein ID
| CDBP05278 |
| Secondary Accession Numbers
| Not Available |
| Name
| Ethylmalonyl-CoA decarboxylase |
| Description
| Not Available |
| Synonyms
|
- Enoyl-CoA hydratase domain-containing protein 1
- Methylmalonyl-CoA decarboxylase
- MMCD
|
| Gene Name
| ECHDC1 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Decarboxylases ethylmalonyl-CoA decarboxylase, a potentially toxic metabolite, to form butyryl-CoA, suggesting it might be involved in metabolite proofreading. Also has methylmalonyl-CoA decarboxylase activityx at lower level.
|
| GO Classification
|
| Cellular Component |
| cytosol |
| Molecular Function |
| carboxy-lyase activity |
| methylmalonyl-CoA decarboxylase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 6 |
| Locus
| 6q22.33 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 32996.93 |
| Theoretical pI
| 8.213 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|157694516|ref|NP_001002030.1| ethylmalonyl-CoA decarboxylase isoform 1 [Homo sapiens]
MAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGI
LTLNNPSRMN
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NTX5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:21489 |
| References |
| General References
| Not Available |