| Identification |
|---|
| HMDB Protein ID
| CDBP05274 |
| Secondary Accession Numbers
| Not Available |
| Name
| Dual specificity protein phosphatase 23 |
| Description
| Not Available |
| Synonyms
|
- Low molecular mass dual specificity phosphatase 3
- VH1-like phosphatase Z
- LDP-3
|
| Gene Name
| DUSP23 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).
|
| GO Classification
|
| Biological Process |
| peptidyl-tyrosine dephosphorylation |
| Cellular Component |
| cytosol |
| nucleus |
| Molecular Function |
| protein tyrosine/serine/threonine phosphatase activity |
| protein tyrosine phosphatase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 1 |
| Locus
| 1q23.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 16587.985 |
| Theoretical pI
| 8.213 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|56786144|ref|NP_060293.2| dual specificity protein phosphatase 23 [Homo sapiens]
MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHR
LRIPDFCPPA
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9BVJ7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:21480 |
| References |
|---|
| General References
| Not Available |