| Identification |
|---|
| HMDB Protein ID
| CDBP05268 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA polymerase subunit gamma-2, mitochondrial |
| Description
| Not Available |
| Synonyms
|
- DNA polymerase gamma accessory 55 kDa subunit
- Mitochondrial DNA polymerase accessory subunit
- MtPolB
- PolG-beta
- p55
|
| Gene Name
| POLG2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Mitochondrial polymerase processivity subunit. Stimulates the polymerase and exonuclease activities, and increases the processivity of the enzyme. Binds to ss-DNA.
|
| GO Classification
|
| Biological Process |
| DNA repair |
| DNA-dependent DNA replication |
| glycyl-tRNA aminoacylation |
| Cellular Component |
| mitochondrial chromosome |
| Molecular Function |
| ATP binding |
| single-stranded DNA binding |
| DNA-directed DNA polymerase activity |
| glycine-tRNA ligase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 17 |
| Locus
| 17q |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 54910.67 |
| Theoretical pI
| 8.36 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|70887790|ref|NP_009146.2| DNA polymerase subunit gamma-2, mitochondrial [Homo sapiens]
MRSRVAVRACHKVCRCLLSGFGGRVDAGQPELLTERSSPKGGHVKSHAELEGNGEHPEAP
GSGEGSEALL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UHN1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:9180 |
| References |
|---|
| General References
| Not Available |