| Identification |
|---|
| HMDB Protein ID
| CDBP05260 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable dimethyladenosine transferase |
| Description
| Not Available |
| Synonyms
|
- DIM1 dimethyladenosine transferase 1 homolog
- DIM1 dimethyladenosine transferase 1-like
- Probable 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase
- Probable 18S rRNA dimethylase
- Probable S-adenosylmethionine-6-N',N'-adenosyl(rRNA) dimethyltransferase
|
| Gene Name
| DIMT1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Specifically dimethylates two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 18S rRNA in the 40S particle (By similarity).
|
| GO Classification
|
| Biological Process |
| rRNA methylation |
| Cellular Component |
| nucleolus |
| Molecular Function |
| 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase activity |
| rRNA (adenine-N6,N6-)-dimethyltransferase activity |
| RNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5q12.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 35236.07 |
| Theoretical pI
| 9.996 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|7657198|ref|NP_055288.1| probable dimethyladenosine transferase [Homo sapiens]
MPKVKSGAIGRRRGRQEQRRELKSAGGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVV
LEVGPGTGNM
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UNQ2 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:30217 |
| References |
|---|
| General References
| Not Available |