Identification |
HMDB Protein ID
| CDBP05257 |
Secondary Accession Numbers
| Not Available |
Name
| Probable ATP-dependent RNA helicase DHX58 |
Description
| Not Available |
Synonyms
|
- Probable ATP-dependent helicase LGP2
- Protein D11Lgp2 homolog
- RIG-I-like receptor 3
- RIG-I-like receptor LGP2
- RLR-3
- RLR
|
Gene Name
| DHX58 |
Protein Type
| Enzyme |
Biological Properties |
General Function
| Not Available |
Specific Function
| Acts as a regulator of DDX58/RIG-I and IFIH1/MDA5 mediated antiviral signaling. Cannot initiate antiviral signaling as it lacks the CARD domain required for activating MAVS/IPS1-dependent signaling events. Can have both negative and positive regulatory functions related to DDX58/RIG-I and IFIH1/MDA5 signaling and this role in regulating signaling may be complex and could probably depend on characteristics of the infecting virus or target cells, or both. Its inhibitory action on DDX58/RIG-I signaling may involve the following mechanisms: competition with DDX58/RIG-I for binding to the viral RNA, binding to DDX58/RIG-I and inhibiting its dimerization and interaction with MAVS/IPS1, competing with IKBKE in its binding to MAVS/IPS1 thereby inhibiting activation of interferon regulatory factor 3 (IRF3). Its positive regulatory role may involve unwinding or stripping nucleoproteins of viral RNA thereby facilitating their recognition by DDX58/RIG-I and IFIH1/MDA5. Involved in the innate immune response to various RNA viruses and some DNA viruses such as poxviruses, and also to the bacterial pathogen Listeria monocytogenes. Can bind both ssRNA and dsRNA, with a higher affinity for dsRNA. Shows a preference to 5'-triphosphorylated RNA, although it can recognize RNA lacking a 5'-triphosphate.
|
GO Classification
|
Biological Process |
response to virus |
negative regulation of type I interferon production |
defense response to virus |
innate immune response |
positive regulation of MDA-5 signaling pathway |
virus-host interaction |
positive regulation of RIG-I signaling pathway |
negative regulation of innate immune response |
negative regulation of MDA-5 signaling pathway |
negative regulation of RIG-I signaling pathway |
positive regulation of type I interferon production |
Cellular Component |
cytoplasm |
Molecular Function |
zinc ion binding |
DNA binding |
helicase activity |
metal ion binding |
double-stranded RNA binding |
ATP binding |
single-stranded RNA binding |
|
Cellular Location
|
Not Available
|
Pathways
|
Name | SMPDB/Pathwhiz | KEGG | RIG-I-like receptor signaling pathway | Not Available |  |
|
Gene Properties |
Chromosome Location
| 17 |
Locus
| 17q21.2 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 76612.365 |
Theoretical pI
| 7.371 |
Pfam Domain Function
|
Not Available |
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>gi|149408122|ref|NP_077024.2| probable ATP-dependent RNA helicase DHX58 [Homo sapiens]
MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLV
TQHGEEFRRM
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| Q96C10 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
|
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:29517 |
References |
General References
| Not Available |