| Identification |
|---|
| HMDB Protein ID
| CDBP05252 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable ATP-dependent RNA helicase DHX35 |
| Description
| Not Available |
| Synonyms
|
- DEAH box protein 35
|
| Gene Name
| DHX35 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| May be involved in pre-mRNA splicing.
|
| GO Classification
|
| Biological Process |
| mRNA splicing, via spliceosome |
| Cellular Component |
| catalytic step 2 spliceosome |
| Molecular Function |
| nucleic acid binding |
| ATP binding |
| ATP-dependent helicase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 20 |
| Locus
| 20q11.22-q12 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 78909.65 |
| Theoretical pI
| 8.588 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|20544129|ref|NP_068750.2| probable ATP-dependent RNA helicase DHX35 isoform 1 [Homo sapiens]
MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQRQKLPVFKLR
NHILYLIENY
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H5Z1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:15861 |
| References |
|---|
| General References
| Not Available |