Showing Protein Putative ATP-dependent RNA helicase DHX33 (CDBP05250)
| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | CDBP05250 | |||||||||
| Secondary Accession Numbers | Not Available | |||||||||
| Name | Putative ATP-dependent RNA helicase DHX33 | |||||||||
| Description | Not Available | |||||||||
| Synonyms |
|
|||||||||
| Gene Name | DHX33 | |||||||||
| Protein Type | Enzyme | |||||||||
| Biological Properties | ||||||||||
| General Function | Not Available | |||||||||
| Specific Function | Stimulates RNA polymerase I transcription of the 47S precursor rRNA. Associates with ribosomal DNA (rDNA) loci where it is involved in POLR1A recruitment. Important element of nucleolar organization. | |||||||||
| GO Classification |
|
|||||||||
| Cellular Location | Not Available | |||||||||
| Pathways | Not Available | |||||||||
| Gene Properties | ||||||||||
| Chromosome Location | 17 | |||||||||
| Locus | 17p13.2 | |||||||||
| SNPs | Not Available | |||||||||
| Gene Sequence | Not Available | |||||||||
| Protein Properties | ||||||||||
| Number of Residues | Not Available | |||||||||
| Molecular Weight | 60392.585 | |||||||||
| Theoretical pI | 8.345 | |||||||||
| Pfam Domain Function | Not Available | |||||||||
| Signals | Not Available | |||||||||
| Transmembrane Regions | Not Available | |||||||||
| Protein Sequence |
>gi|315113911|ref|NP_001186628.1| putative ATP-dependent RNA helicase DHX33 isoform 2 [Homo sapiens] MLLREAISDSLLRKYSCVILDEAHERTIHTDVLFGVVKAAQKRRKELGKLPLKVIVMSAT MDVDLFSQYF |
|||||||||
| External Links | ||||||||||
| GenBank ID Protein | Not Available | |||||||||
| UniProtKB/Swiss-Prot ID | Q9H6R0 | |||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
| PDB IDs | Not Available | |||||||||
| GenBank Gene ID | Not Available | |||||||||
| GeneCard ID | Not Available | |||||||||
| GenAtlas ID | Not Available | |||||||||
| HGNC ID | HGNC:16718 | |||||||||
| References | ||||||||||
| General References | Not Available | |||||||||