Showing Protein ATP-dependent RNA helicase DHX29 (CDBP05247)
Identification | |||||||
---|---|---|---|---|---|---|---|
HMDB Protein ID | CDBP05247 | ||||||
Secondary Accession Numbers | Not Available | ||||||
Name | ATP-dependent RNA helicase DHX29 | ||||||
Description | Not Available | ||||||
Synonyms |
|
||||||
Gene Name | DHX29 | ||||||
Protein Type | Enzyme | ||||||
Biological Properties | |||||||
General Function | Not Available | ||||||
Specific Function | ATP-binding RNA helicase involved in translation initiation. Required for efficient initiation on mammalian mRNAs with structured 5'-UTRs by promoting efficient NTPase-dependent 48S complex formation. Specifically binds to the 40S ribosome near the mRNA entrance. Does not possess a processive helicase activity. | ||||||
GO Classification |
|
||||||
Cellular Location | Not Available | ||||||
Pathways | Not Available | ||||||
Gene Properties | |||||||
Chromosome Location | 5 | ||||||
Locus | 5q11.2 | ||||||
SNPs | Not Available | ||||||
Gene Sequence | Not Available | ||||||
Protein Properties | |||||||
Number of Residues | Not Available | ||||||
Molecular Weight | 155234.3 | ||||||
Theoretical pI | 8.092 | ||||||
Pfam Domain Function | Not Available | ||||||
Signals | Not Available | ||||||
Transmembrane Regions | Not Available | ||||||
Protein Sequence |
>gi|67782362|ref|NP_061903.2| ATP-dependent RNA helicase DHX29 [Homo sapiens] MGGKNKKHKAPAAAVVRAAVSASRAKSAEAGIAGEAQSKKPVSRPATAAAAAAGSREPRV KQGPKIYSFN |
||||||
External Links | |||||||
GenBank ID Protein | Not Available | ||||||
UniProtKB/Swiss-Prot ID | Q7Z478 | ||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
PDB IDs | Not Available | ||||||
GenBank Gene ID | Not Available | ||||||
GeneCard ID | Not Available | ||||||
GenAtlas ID | Not Available | ||||||
HGNC ID | HGNC:15815 | ||||||
References | |||||||
General References | Not Available |