Showing Protein ATP-dependent RNA helicase DHX29 (CDBP05247)
| Identification | |||||||
|---|---|---|---|---|---|---|---|
| HMDB Protein ID | CDBP05247 | ||||||
| Secondary Accession Numbers | Not Available | ||||||
| Name | ATP-dependent RNA helicase DHX29 | ||||||
| Description | Not Available | ||||||
| Synonyms |
|
||||||
| Gene Name | DHX29 | ||||||
| Protein Type | Enzyme | ||||||
| Biological Properties | |||||||
| General Function | Not Available | ||||||
| Specific Function | ATP-binding RNA helicase involved in translation initiation. Required for efficient initiation on mammalian mRNAs with structured 5'-UTRs by promoting efficient NTPase-dependent 48S complex formation. Specifically binds to the 40S ribosome near the mRNA entrance. Does not possess a processive helicase activity. | ||||||
| GO Classification |
|
||||||
| Cellular Location | Not Available | ||||||
| Pathways | Not Available | ||||||
| Gene Properties | |||||||
| Chromosome Location | 5 | ||||||
| Locus | 5q11.2 | ||||||
| SNPs | Not Available | ||||||
| Gene Sequence | Not Available | ||||||
| Protein Properties | |||||||
| Number of Residues | Not Available | ||||||
| Molecular Weight | 155234.3 | ||||||
| Theoretical pI | 8.092 | ||||||
| Pfam Domain Function | Not Available | ||||||
| Signals | Not Available | ||||||
| Transmembrane Regions | Not Available | ||||||
| Protein Sequence |
>gi|67782362|ref|NP_061903.2| ATP-dependent RNA helicase DHX29 [Homo sapiens] MGGKNKKHKAPAAAVVRAAVSASRAKSAEAGIAGEAQSKKPVSRPATAAAAAAGSREPRV KQGPKIYSFN |
||||||
| External Links | |||||||
| GenBank ID Protein | Not Available | ||||||
| UniProtKB/Swiss-Prot ID | Q7Z478 | ||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
| PDB IDs | Not Available | ||||||
| GenBank Gene ID | Not Available | ||||||
| GeneCard ID | Not Available | ||||||
| GenAtlas ID | Not Available | ||||||
| HGNC ID | HGNC:15815 | ||||||
| References | |||||||
| General References | Not Available | ||||||