| Identification |
|---|
| HMDB Protein ID
| CDBP05247 |
| Secondary Accession Numbers
| Not Available |
| Name
| ATP-dependent RNA helicase DHX29 |
| Description
| Not Available |
| Synonyms
|
- DEAH box protein 29
- Nucleic acid helicase DDXx
|
| Gene Name
| DHX29 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| ATP-binding RNA helicase involved in translation initiation. Required for efficient initiation on mammalian mRNAs with structured 5'-UTRs by promoting efficient NTPase-dependent 48S complex formation. Specifically binds to the 40S ribosome near the mRNA entrance. Does not possess a processive helicase activity.
|
| GO Classification
|
| Cellular Component |
| mitochondrion |
| Molecular Function |
| ATP-dependent helicase activity |
| translation initiation factor activity |
| ATP binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5q11.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 155234.3 |
| Theoretical pI
| 8.092 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|67782362|ref|NP_061903.2| ATP-dependent RNA helicase DHX29 [Homo sapiens]
MGGKNKKHKAPAAAVVRAAVSASRAKSAEAGIAGEAQSKKPVSRPATAAAAAAGSREPRV
KQGPKIYSFN
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q7Z478 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:15815 |
| References |
|---|
| General References
| Not Available |