Cannabis Compound Database: Showing Protein Probable ATP-dependent RNA helicase DDX5 (CDBP05242)

Identification Biological properties Gene properties Protein properties External links References XML Show 3 compounds

Identification

HMDB Protein ID

CDBP05242

Secondary Accession Numbers

Not Available

Name

Probable ATP-dependent RNA helicase DDX5

Description

Not Available

Synonyms

DEAD box protein 5
RNA helicase p68

Gene Name

DDX5

Protein Type

Enzyme

Biological Properties

General Function

Not Available

Specific Function

Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon 10. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Involved in transcriptional regulation; the function is independent of the RNA helicase activity. Transcriptional coactivator for estrogen receptor ESR1 and androgen receptor AR. Increases ESR1 AF-1 domain-mediated transactivation and ESR1 AF-1 and AF-2 domains transcriptional synergistic activity. Synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and involved in skeletal muscle differentiation. Transcriptional coactivator for p53/TP53 and involved in p53/TP53 transcriptional response to DNA damage and p53/TP53-dependent apoptosis. Transcriptional coactivator for RUNX2 and involved in regulation of osteoblast differentiation. Acts as transcriptional repressor in a promoter-specicic manner; the function probbaly involves association with histone deacetylases, such as HDAC1.

GO Classification

Biological Process
negative regulation of transcription from RNA polymerase II promoter
positive regulation of transcription from RNA polymerase II promoter
transcription, DNA-dependent
positive regulation of intracellular estrogen receptor signaling pathway
regulation of skeletal muscle cell differentiation
in utero embryonic development
mRNA splicing, via spliceosome
cell growth
intrinsic apoptotic signaling pathway by p53 class mediator
positive regulation of DNA damage response, signal transduction by p53 class mediator
regulation of alternative mRNA splicing, via spliceosome
regulation of androgen receptor signaling pathway
regulation of osteoblast differentiation
regulation of viral genome replication
Cellular Component
nucleolus
catalytic step 2 spliceosome
Molecular Function
RNA helicase activity
ATP-dependent RNA helicase activity
ATP binding
estrogen receptor binding
transcription coactivator activity
androgen receptor binding
pre-mRNA binding

Cellular Location

Not Available

Pathways

Name	SMPDB/Pathwhiz	KEGG
Spliceosome	Not Available
Transcriptional misregulation in cancer	Not Available
Proteoglycans in cancer	Not Available

Gene Properties

Chromosome Location

Locus

17q21

SNPs

Not Available

Gene Sequence

Not Available

Protein Properties

Number of Residues

Not Available

Molecular Weight

69147.585

Theoretical pI

8.924

Pfam Domain Function

P68HR (PF08061 )

Signals

Not Available

Transmembrane Regions

Not Available

Protein Sequence

>gi|4758138|ref|NP_004387.1| probable ATP-dependent RNA helicase DDX5 [Homo sapiens]
MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQ
EHPDLARRTA

External Links

GenBank ID Protein

Not Available

UniProtKB/Swiss-Prot ID

P17844

UniProtKB/Swiss-Prot Entry Name

Not Available

PDB IDs