| Identification |
|---|
| HMDB Protein ID
| CDBP05234 |
| Secondary Accession Numbers
| Not Available |
| Name
| ATP-dependent RNA helicase DDX51 |
| Description
| Not Available |
| Synonyms
|
- DEAD box protein 51
|
| Gene Name
| DDX51 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| ATP-binding RNA helicase involved in the biogenesis of 60S ribosomal subunits (By similarity).
|
| GO Classification
|
| Biological Process |
| rRNA processing |
| Cellular Component |
| nucleolus |
| Molecular Function |
| ATP binding |
| ATP-dependent helicase activity |
| RNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 12 |
| Locus
| 12q24.33 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 72456.645 |
| Theoretical pI
| 8.169 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|154759257|ref|NP_778236.2| ATP-dependent RNA helicase DDX51 [Homo sapiens]
MALFYVARYPGPDAAAAAGPEGAEAGAHGRARALLERLQSRARERQQQREPAQTEAAAST
EPATRRRRRP
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8N8A6 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20082 |
| References |
|---|
| General References
| Not Available |