| Identification |
|---|
| HMDB Protein ID
| CDBP05232 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable ATP-dependent RNA helicase DDX4 |
| Description
| Not Available |
| Synonyms
|
- DEAD box protein 4
- Vasa homolog
|
| Gene Name
| DDX4 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| May play a role in germ cell development. May play a role in sperm motility.
|
| GO Classification
|
| Biological Process |
| multicellular organismal development |
| spermatogenesis |
| leptotene |
| male meiosis I |
| sperm motility |
| regulation of protein localization |
| Cellular Component |
| nucleus |
| chromatoid body |
| pi-body |
| piP-body |
| perinuclear region of cytoplasm |
| Molecular Function |
| nucleic acid binding |
| ATP binding |
| ATP-dependent helicase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5p15.2-p13.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 75820.165 |
| Theoretical pI
| 5.494 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|216548263|ref|NP_001136021.1| probable ATP-dependent RNA helicase DDX4 isoform 2 [Homo sapiens]
MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFA
SGRNFGNRDA
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NQI0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18700 |
| References |
|---|
| General References
| Not Available |