| Identification |
|---|
| HMDB Protein ID
| CDBP05230 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable ATP-dependent RNA helicase DDX47 |
| Description
| Not Available |
| Synonyms
|
- DEAD box protein 47
|
| Gene Name
| DDX47 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Involved in apoptosis. May have a role in rRNA processing and mRNA splicing. Associates with pre-rRNA precursors.
|
| GO Classification
|
| Biological Process |
| apoptotic process |
| mRNA processing |
| RNA splicing |
| rRNA processing |
| Cellular Component |
| nucleolus |
| Molecular Function |
| nucleic acid binding |
| ATP binding |
| ATP-dependent helicase activity |
| RNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 12 |
| Locus
| 12p13.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 50646.07 |
| Theoretical pI
| 9.103 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|20149629|ref|NP_057439.2| probable ATP-dependent RNA helicase DDX47 isoform 1 [Homo sapiens]
MAAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQ
GRDIIGLAET
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H0S4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18682 |
| References |
|---|
| General References
| Not Available |