| Identification |
|---|
| HMDB Protein ID
| CDBP05227 |
| Secondary Accession Numbers
| Not Available |
| Name
| ATP-dependent RNA helicase DDX42 |
| Description
| Not Available |
| Synonyms
|
- DEAD box protein 42
- RNA helicase-like protein
- RNA helicase-related protein
- SF3b DEAD box protein
- Splicing factor 3B-associated 125 kDa protein
- RHELP
- RNAHP
- SF3b125
|
| Gene Name
| DDX42 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| ATP-dependent RNA helicase. Binds to partially double-stranded RNAs (dsRNAs) in order to unwind RNA secondary structures. Unwinding is promoted in the presence of single-strand binding proteins. Mediates also RNA duplex formation thereby displacing the single-strand RNA binding protein. ATP and ADP modulate its activity: ATP binding and hydrolysis by DDX42 triggers RNA strand separation, whereas the ADP-bound form of the protein triggers annealing of complementary RNA strands. Involved in the survival of cells by interacting with TP53BP2 and thereby counteracting the apoptosis-stimulating activity of TP53BP2. Relocalizes TP53BP2 to the cytoplasm.
|
| GO Classification
|
| Biological Process |
| protein localization |
| Cellular Component |
| cytoplasm |
| nucleus |
| Cajal body |
| nuclear speck |
| Molecular Function |
| ATP binding |
| ATP-dependent helicase activity |
| RNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Spliceosome | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 17 |
| Locus
| 17q23.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 102974.485 |
| Theoretical pI
| 7.015 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|45446743|ref|NP_031398.2| ATP-dependent RNA helicase DDX42 [Homo sapiens]
MNWNKGGPGTKRGFGFGGFAISAGKKEEPKLPQQSHSAFGATSSSSGFGKSAPPQLPSFY
KIGSKRANFD
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q86XP3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18676 |
| References |
|---|
| General References
| Not Available |