| Identification |
|---|
| HMDB Protein ID
| CDBP05222 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable ATP-dependent RNA helicase DDX28 |
| Description
| Not Available |
| Synonyms
|
- Mitochondrial DEAD box protein 28
|
| Gene Name
| DDX28 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| May be involved in RNA processing or transport. Has RNA and Mg(2+)-dependent ATPase activity.
|
| GO Classification
|
| Cellular Component |
| nucleolus |
| mitochondrial nucleoid |
| Molecular Function |
| ATP binding |
| ATP-dependent helicase activity |
| RNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 16 |
| Locus
| 16q22.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 59580.575 |
| Theoretical pI
| 10.42 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|256773275|ref|NP_060850.2| probable ATP-dependent RNA helicase DDX28 [Homo sapiens]
MALTRPVRLFSLVTRLLLAPRRGLTVRSPDEPLPVVRIPVALQRQLEQRQSRRRNLPRPV
LVRPGPLLVS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NUL7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17330 |
| References |
|---|
| General References
| Not Available |