| Identification |
|---|
| HMDB Protein ID
| CDBP05220 |
| Secondary Accession Numbers
| Not Available |
| Name
| ATP-dependent RNA helicase DDX25 |
| Description
| Not Available |
| Synonyms
|
- DEAD box protein 25
- Gonadotropin-regulated testicular RNA helicase
|
| Gene Name
| DDX25 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| ATP-dependent RNA helicase. Required for mRNA export and translation regulation during spermatid development (By similarity).
|
| GO Classification
|
| Biological Process |
| multicellular organismal development |
| mRNA export from nucleus |
| spermatid development |
| regulation of translation |
| Cellular Component |
| nucleus |
| chromatoid body |
| Molecular Function |
| ATP binding |
| RNA binding |
| ATP-dependent RNA helicase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 11 |
| Locus
| 11q24 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 54691.51 |
| Theoretical pI
| 6.276 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|164419732|ref|NP_037396.3| ATP-dependent RNA helicase DDX25 [Homo sapiens]
MASLLWGGDAGAAESERLNSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVD
LAANSLLNKL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UHL0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18698 |
| References |
|---|
| General References
| Not Available |