| Identification |
|---|
| HMDB Protein ID
| CDBP05217 |
| Secondary Accession Numbers
| Not Available |
| Name
| Nucleolar RNA helicase 2 |
| Description
| Not Available |
| Synonyms
|
- DEAD box protein 21
- Gu-alpha
- Nucleolar RNA helicase Gu
- Nucleolar RNA helicase II
- RH II/Gu
|
| Gene Name
| DDX21 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Can unwind double-stranded RNA (helicase) and can fold or introduce a secondary structure to a single-stranded RNA (foldase). Functions as cofactor for JUN-activated transcription. Involved in rRNA processing.
|
| GO Classification
|
| Biological Process |
| response to exogenous dsRNA |
| response to virus |
| Cellular Component |
| nucleolus |
| Molecular Function |
| ATP-dependent RNA helicase activity |
| double-stranded RNA binding |
| ATP binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 10 |
| Locus
| 10q21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 79656.25 |
| Theoretical pI
| 9.38 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|379317177|ref|NP_001243839.1| nucleolar RNA helicase 2 isoform 2 [Homo sapiens]
MNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAP
KPKKMKKEKE
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NR30 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:2744 |
| References |
|---|
| General References
| Not Available |