Identification |
HMDB Protein ID
| CDBP05215 |
Secondary Accession Numbers
| Not Available |
Name
| ATP-dependent RNA helicase DDX1 |
Description
| Not Available |
Synonyms
|
- DEAD box protein 1
- DEAD box protein retinoblastoma
- DBP-RB
|
Gene Name
| DDX1 |
Protein Type
| Enzyme |
Biological Properties |
General Function
| Not Available |
Specific Function
| Acts as an ATP-dependent RNA helicase, able to unwind both RNA-RNA and RNA-DNA duplexes. Possesses 5' single-stranded RNA overhang nuclease activity. Possesses ATPase activity on various RNA, but not DNA polynucleotides. May play a role in RNA clearance at DNA double-strand breaks (DSBs), thereby facilitating the template-guided repair of transcriptionally active regions of the genome. Together with RELA, acts as a coactivator to enhance NF-kappa-B-mediated transcriptional activation. Acts as a positive transcriptional regulator of cyclin CCND2 expression. Binds to the cyclin CCND2 promoter region. Associates with chromatin at the NF-kappa-B promoter region via association with RELA. Binds to poly(A) RNA. May be involved in 3'-end cleavage and polyadenylation of pre-mRNAs. Required for HIV-1 Rev function as well as for HIV-1 replication. Binds to the RRE sequence of HIV-1 mRNAs.
|
GO Classification
|
Biological Process |
multicellular organismal development |
DNA duplex unwinding |
double-strand break repair |
regulation of translational initiation |
response to exogenous dsRNA |
spliceosomal complex assembly |
response to virus |
regulation of transcription, DNA-dependent |
transcription, DNA-dependent |
Cellular Component |
cleavage body |
cytoplasmic stress granule |
tRNA-splicing ligase complex |
Molecular Function |
nuclease activity |
poly(A) RNA binding |
ATP binding |
ATP-dependent helicase activity |
chromatin binding |
DNA binding |
transcription cofactor activity |
RNA helicase activity |
DNA/RNA helicase activity |
double-stranded RNA binding |
exonuclease activity |
|
Cellular Location
|
Not Available
|
Pathways
|
Not Available
|
Gene Properties |
Chromosome Location
| 2 |
Locus
| 2p24 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 82431.675 |
Theoretical pI
| 7.222 |
Pfam Domain Function
|
Not Available |
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>gi|4826686|ref|NP_004930.1| ATP-dependent RNA helicase DDX1 [Homo sapiens]
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
IQIVYETLKD
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| Q92499 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
Not Available |
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:2734 |
References |
General References
| Not Available |