Showing Protein ATP-dependent RNA helicase DDX1 (CDBP05215)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 3 compounds
Identification
HMDB Protein ID CDBP05215
Secondary Accession Numbers Not Available
Name ATP-dependent RNA helicase DDX1
Description Not Available
Synonyms
  1. DEAD box protein 1
  2. DEAD box protein retinoblastoma
  3. DBP-RB
Gene Name DDX1
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Acts as an ATP-dependent RNA helicase, able to unwind both RNA-RNA and RNA-DNA duplexes. Possesses 5' single-stranded RNA overhang nuclease activity. Possesses ATPase activity on various RNA, but not DNA polynucleotides. May play a role in RNA clearance at DNA double-strand breaks (DSBs), thereby facilitating the template-guided repair of transcriptionally active regions of the genome. Together with RELA, acts as a coactivator to enhance NF-kappa-B-mediated transcriptional activation. Acts as a positive transcriptional regulator of cyclin CCND2 expression. Binds to the cyclin CCND2 promoter region. Associates with chromatin at the NF-kappa-B promoter region via association with RELA. Binds to poly(A) RNA. May be involved in 3'-end cleavage and polyadenylation of pre-mRNAs. Required for HIV-1 Rev function as well as for HIV-1 replication. Binds to the RRE sequence of HIV-1 mRNAs.
GO Classification
Biological Process
multicellular organismal development
DNA duplex unwinding
double-strand break repair
regulation of translational initiation
response to exogenous dsRNA
spliceosomal complex assembly
response to virus
regulation of transcription, DNA-dependent
transcription, DNA-dependent
Cellular Component
cleavage body
cytoplasmic stress granule
tRNA-splicing ligase complex
Molecular Function
nuclease activity
poly(A) RNA binding
ATP binding
ATP-dependent helicase activity
chromatin binding
DNA binding
transcription cofactor activity
RNA helicase activity
DNA/RNA helicase activity
double-stranded RNA binding
exonuclease activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 2
Locus 2p24
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 82431.675
Theoretical pI 7.222
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>gi|4826686|ref|NP_004930.1| ATP-dependent RNA helicase DDX1 [Homo sapiens]
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
IQIVYETLKD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q92499
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:2734
References
General References Not Available