| Identification |
|---|
| HMDB Protein ID
| CDBP05215 |
| Secondary Accession Numbers
| Not Available |
| Name
| ATP-dependent RNA helicase DDX1 |
| Description
| Not Available |
| Synonyms
|
- DEAD box protein 1
- DEAD box protein retinoblastoma
- DBP-RB
|
| Gene Name
| DDX1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Acts as an ATP-dependent RNA helicase, able to unwind both RNA-RNA and RNA-DNA duplexes. Possesses 5' single-stranded RNA overhang nuclease activity. Possesses ATPase activity on various RNA, but not DNA polynucleotides. May play a role in RNA clearance at DNA double-strand breaks (DSBs), thereby facilitating the template-guided repair of transcriptionally active regions of the genome. Together with RELA, acts as a coactivator to enhance NF-kappa-B-mediated transcriptional activation. Acts as a positive transcriptional regulator of cyclin CCND2 expression. Binds to the cyclin CCND2 promoter region. Associates with chromatin at the NF-kappa-B promoter region via association with RELA. Binds to poly(A) RNA. May be involved in 3'-end cleavage and polyadenylation of pre-mRNAs. Required for HIV-1 Rev function as well as for HIV-1 replication. Binds to the RRE sequence of HIV-1 mRNAs.
|
| GO Classification
|
| Biological Process |
| multicellular organismal development |
| DNA duplex unwinding |
| double-strand break repair |
| regulation of translational initiation |
| response to exogenous dsRNA |
| spliceosomal complex assembly |
| response to virus |
| regulation of transcription, DNA-dependent |
| transcription, DNA-dependent |
| Cellular Component |
| cleavage body |
| cytoplasmic stress granule |
| tRNA-splicing ligase complex |
| Molecular Function |
| nuclease activity |
| poly(A) RNA binding |
| ATP binding |
| ATP-dependent helicase activity |
| chromatin binding |
| DNA binding |
| transcription cofactor activity |
| RNA helicase activity |
| DNA/RNA helicase activity |
| double-stranded RNA binding |
| exonuclease activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 2 |
| Locus
| 2p24 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 82431.675 |
| Theoretical pI
| 7.222 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|4826686|ref|NP_004930.1| ATP-dependent RNA helicase DDX1 [Homo sapiens]
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
IQIVYETLKD
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q92499 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:2734 |
| References |
|---|
| General References
| Not Available |