| Identification |
| HMDB Protein ID
| CDBP05209 |
| Secondary Accession Numbers
| Not Available |
| Name
| ATP-dependent RNA helicase DDX19B |
| Description
| Not Available |
| Synonyms
|
- DEAD box RNA helicase DEAD5
- DEAD box protein 19B
|
| Gene Name
| DDX19B |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| ATP-dependent RNA helicase involved in mRNA export from the nucleus. Rather than unwinding RNA duplexes, DDX19B functions as a remodeler of ribonucleoprotein particles, whereby proteins bound to nuclear mRNA are dissociated and replaced by cytoplasmic mRNA binding proteins.
|
| GO Classification
|
| Biological Process |
| protein transport |
| mRNA export from nucleus |
| Cellular Component |
| cytoplasm |
| nuclear pore |
| nuclear membrane |
| Molecular Function |
| ATP binding |
| ATP-dependent helicase activity |
| RNA binding |
| helicase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 16 |
| Locus
| 16q22.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 41779.035 |
| Theoretical pI
| 7.879 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|62241022|ref|NP_001014449.1| ATP-dependent RNA helicase DDX19B isoform 3 [Homo sapiens]
MGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLS
PTYELALQTG
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UMR2 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:2742 |
| References |
| General References
| Not Available |