| Identification |
| HMDB Protein ID
| CDBP05207 |
| Secondary Accession Numbers
| Not Available |
| Name
| dCTP pyrophosphatase 1 |
| Description
| Not Available |
| Synonyms
|
- Deoxycytidine-triphosphatase 1
- RS21C6
- XTP3-transactivated gene A protein
- dCTPase 1
|
| Gene Name
| DCTPP1 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for modified dCTP. Activity is highest with 5-iodo-dCTP, followed by 5-bromo-dCTP, unmodified dCTP, 5-methyl-dCTP and 5-chloro-dCTP. Hydrolyzes 2-chloro-dATP and 2-hydroxy-dATP with lower efficiency, and has even lower activity with unmodified dATP, dTTP and dUTP (in vitro). Does not hydrolyze ATP, UTP, ITP, GTP, dADP, dCDP or dGTP. May protect DNA or RNA against the incorporation of non-canonical nucleotide triphosphates. May protect cells against inappropriate methylation of CpG islands by DNA methyltransferases (By similarity).
|
| GO Classification
|
| Biological Process |
| nucleoside triphosphate catabolic process |
| protein homotetramerization |
| Cellular Component |
| cytosol |
| Molecular Function |
| magnesium ion binding |
| dCTP diphosphatase activity |
| nucleoside-triphosphate diphosphatase activity |
| pyrimidine deoxyribonucleotide binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 16 |
| Locus
| 16p11.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 18680.645 |
| Theoretical pI
| 5.031 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|13129100|ref|NP_077001.1| dCTP pyrophosphatase 1 [Homo sapiens]
MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLAL
VGEVGELAEL
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H773 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:28777 |
| References |
| General References
| Not Available |