| Identification |
| HMDB Protein ID
| CDBP05203 |
| Secondary Accession Numbers
| Not Available |
| Name
| CTD small phosphatase-like protein |
| Description
| Not Available |
| Synonyms
|
- CTDSP-like
- Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3
- NIF-like protein
- Nuclear LIM interactor-interacting factor 1
- Protein YA22
- RBSP3
- Small C-terminal domain phosphatase 3
- NLI-interacting factor 1
- hYA22
- SCP3
- Small CTD phosphatase 3
|
| Gene Name
| CTDSPL |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation (By similarity). Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.
|
| GO Classification
|
| Biological Process |
| dephosphorylation |
| Cellular Component |
| nucleus |
| Molecular Function |
| phosphoprotein phosphatase activity |
| metal ion binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 3 |
| Locus
| 3p21.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 31128.305 |
| Theoretical pI
| 5.535 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|56549683|ref|NP_001008393.1| CTD small phosphatase-like protein isoform 1 [Homo sapiens]
MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPP
SSPSVLPPLV
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O15194 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:16890 |
| References |
| General References
| Not Available |