| Identification |
| HMDB Protein ID
| CDBP05201 |
| Secondary Accession Numbers
| Not Available |
| Name
| Thiomorpholine-carboxylate dehydrogenase |
| Description
| Not Available |
| Synonyms
|
- Mu-crystallin homolog
- NADP-regulated thyroid-hormone-binding protein
- ketimine reductase
|
| Gene Name
| CRYM |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Specifically catalyzes the reduction of imine bonds in brain substrates that may include cystathionine ketimine (CysK) and lanthionine ketimine (LK). Binds thyroid hormone which is a strong reversible inhibitor. Presumably involved in the regulation of the free intracellular concentration of triiodothyronine and access to its nuclear receptors.
|
| GO Classification
|
| Biological Process |
| sensory perception of sound |
| negative regulation of transcription from RNA polymerase II promoter |
| thyroid hormone metabolic process |
| thyroid hormone transport |
| Cellular Component |
| cytoplasm |
| mitochondrion |
| plasma membrane |
| nucleus |
| Molecular Function |
| thiomorpholine-carboxylate dehydrogenase activity |
| thyroid hormone binding |
| transcription corepressor activity |
| NADP binding |
| protein homodimerization activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 16 |
| Locus
| 16p12.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 29425.425 |
| Theoretical pI
| 5.257 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|62241008|ref|NP_001014444.1| thiomorpholine-carboxylate dehydrogenase isoform 2 [Homo sapiens]
MQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPS
NGTLLAVMDG
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q14894 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:2418 |
| References |
| General References
| Not Available |