Showing Protein Calmodulin-lysine N-methyltransferase (CDBP05199)
| Identification | |||||
|---|---|---|---|---|---|
| HMDB Protein ID | CDBP05199 | ||||
| Secondary Accession Numbers | Not Available | ||||
| Name | Calmodulin-lysine N-methyltransferase | ||||
| Description | Not Available | ||||
| Synonyms |
|
||||
| Gene Name | CAMKMT | ||||
| Protein Type | Enzyme | ||||
| Biological Properties | |||||
| General Function | Not Available | ||||
| Specific Function | Catalyzes the trimethylation of 'Lys-116' in calmodulin. | ||||
| GO Classification |
|
||||
| Cellular Location | Not Available | ||||
| Pathways | Not Available | ||||
| Gene Properties | |||||
| Chromosome Location | 2 | ||||
| Locus | 2p21 | ||||
| SNPs | Not Available | ||||
| Gene Sequence | Not Available | ||||
| Protein Properties | |||||
| Number of Residues | Not Available | ||||
| Molecular Weight | 36127.88 | ||||
| Theoretical pI | 6.831 | ||||
| Pfam Domain Function |
|
||||
| Signals | Not Available | ||||
| Transmembrane Regions | Not Available | ||||
| Protein Sequence |
>gi|13376109|ref|NP_079042.1| calmodulin-lysine N-methyltransferase [Homo sapiens] MESRVADAGTGETARAAGGSPAVGCTTRGPVVSAPLGAARWKLLRQVLKQKHLDDCLRHV SVRRFESFNL |
||||
| External Links | |||||
| GenBank ID Protein | Not Available | ||||
| UniProtKB/Swiss-Prot ID | Q7Z624 | ||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||
| PDB IDs | Not Available | ||||
| GenBank Gene ID | Not Available | ||||
| GeneCard ID | Not Available | ||||
| GenAtlas ID | Not Available | ||||
| HGNC ID | HGNC:26276 | ||||
| References | |||||
| General References | Not Available | ||||