| Identification |
|---|
| HMDB Protein ID
| CDBP05189 |
| Secondary Accession Numbers
| Not Available |
| Name
| Chromodomain-helicase-DNA-binding protein 1-like |
| Description
| Not Available |
| Synonyms
|
- Amplified in liver cancer protein 1
|
| Gene Name
| CHD1L |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| DNA helicase which plays a role in chromatin-remodeling following DNA damage. Targeted to sites of DNA damage through interaction with poly(ADP-ribose) and functions to regulate chromatin during DNA repair. Able to catalyze nucleosome sliding in an ATP-dependent manner. Helicase activity is strongly stimulated upon poly(ADP-ribose)-binding.
|
| GO Classification
|
| Biological Process |
| DNA repair |
| chromatin remodeling |
| Cellular Component |
| cytoplasm |
| plasma membrane |
| nucleus |
| Molecular Function |
| ATP binding |
| ATP-dependent DNA helicase activity |
| DNA binding |
| nucleotide binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 1 |
| Locus
| 1q12 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 89974.62 |
| Theoretical pI
| 7.02 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|373432615|ref|NP_001243265.1| chromodomain-helicase-DNA-binding protein 1-like isoform 2 [Homo sapiens]
MAVSWEMRWAWGRPARFAPGLSCVTYAGDKEERACLQQDLKQESRFHVLLTTYEICLKDA
SFLKSFPWSV
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q86WJ1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:1916 |
| References |
|---|
| General References
| Not Available |