| Identification |
| HMDB Protein ID
| CDBP05177 |
| Secondary Accession Numbers
| Not Available |
| Name
| ATPase family AAA domain-containing protein 1 |
| Description
| Not Available |
| Synonyms
|
- Thorase
|
| Gene Name
| ATAD1 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| ATPase that plays a critical role in regulating the surface expression of AMPA receptors (AMPAR), thereby regulating synaptic plasticity and learning and memory. Required for NMDA-stimulated AMPAR internalization and inhibition of GRIA1 and GRIA2 recycling back to the plasma membrane; these activities are ATPase-dependent (By similarity).
|
| GO Classification
|
| Biological Process |
| memory |
| learning |
| negative regulation of synaptic transmission, glutamatergic |
| positive regulation of receptor internalization |
| Cellular Component |
| mitochondrion |
| plasma membrane |
| cell junction |
| postsynaptic membrane |
| peroxisomal membrane |
| Molecular Function |
| ATP binding |
| ATPase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Purine Metabolism |    |  | | Adenosine Deaminase Deficiency |    | Not Available | | Adenylosuccinate Lyase Deficiency |    | Not Available | | Gout or Kelley-Seegmiller Syndrome |    | Not Available | | Lesch-Nyhan Syndrome (LNS) |    | Not Available |
|
| Gene Properties |
| Chromosome Location
| 10 |
| Locus
| 10q23.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 40743.65 |
| Theoretical pI
| 6.907 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|31377644|ref|NP_116199.2| ATPase family AAA domain-containing protein 1 [Homo sapiens]
MVHAEAFSRPLSRNEVVGLIFRLTIFGAVTYFTIKWMVDAIDPTRKQKVEAQKQAEKLMK
QIGVKNVKLS
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8NBU5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25903 |
| References |
| General References
| Not Available |