| Identification |
|---|
| HMDB Protein ID
| CDBP05162 |
| Secondary Accession Numbers
| Not Available |
| Name
| Alpha-1,2-mannosyltransferase ALG9 |
| Description
| Not Available |
| Synonyms
|
- Asparagine-linked glycosylation protein 9 homolog
- Disrupted in bipolar disorder protein 1
- Dol-P-Man:Man(6)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
- Dol-P-Man:Man(8)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
|
| Gene Name
| ALG9 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Catalyzes the transfer of mannose from Dol-P-Man to lipid-linked oligosaccharides.
|
| GO Classification
|
| Biological Process |
| GPI anchor biosynthetic process |
| dolichol-linked oligosaccharide biosynthetic process |
| post-translational protein modification |
| protein N-linked glycosylation via asparagine |
| Cellular Component |
| endoplasmic reticulum membrane |
| intrinsic to endoplasmic reticulum membrane |
| integral to membrane |
| Molecular Function |
| dol-P-Man:Man(6)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase activity |
| dol-P-Man:Man(8)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein glycosylation | Not Available | Not Available | | N-Glycan biosynthesis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 11 |
| Locus
| 11q23 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 69862.66 |
| Theoretical pI
| 8.677 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|118026933|ref|NP_001071158.1| alpha-1,2-mannosyltransferase ALG9 isoform b [Homo sapiens]
MASRGARQRLKGSGASSGDTAPAADKLRELLGSREAGGAEHRTELSGNKAGQVWAPEGST
AFKCLLSARL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H6U8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:15672 |
| References |
|---|
| General References
| Not Available |