| Identification |
|---|
| HMDB Protein ID
| CDBP05161 |
| Secondary Accession Numbers
| Not Available |
| Name
| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase |
| Description
| Not Available |
| Synonyms
|
- Asparagine-linked glycosylation protein 12 homolog
- Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase
- Mannosyltransferase ALG12 homolog
- Membrane protein SB87
- hALG12
|
| Gene Name
| ALG12 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Adds the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation.
|
| GO Classification
|
| Biological Process |
| GPI anchor biosynthetic process |
| protein folding |
| dolichol-linked oligosaccharide biosynthetic process |
| post-translational protein modification |
| protein N-linked glycosylation via asparagine |
| Cellular Component |
| endoplasmic reticulum membrane |
| intrinsic to endoplasmic reticulum membrane |
| integral to membrane |
| Molecular Function |
| alpha-1,6-mannosyltransferase activity |
| dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein glycosylation | Not Available | Not Available | | N-Glycan biosynthesis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 22 |
| Locus
| 22q13.33 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 54654.195 |
| Theoretical pI
| 9.586 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|13129114|ref|NP_077010.1| dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase [Homo sapiens]
MAGKGSSGRRPLLLGLLVAVATVHLVICPYTKVEESFNLQATHDLLYHWQDLEQYDHLEF
PGVVPRTFLG
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9BV10 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:19358 |
| References |
|---|
| General References
| Not Available |