| Identification |
|---|
| HMDB Protein ID
| CDBP05160 |
| Secondary Accession Numbers
| Not Available |
| Name
| GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase |
| Description
| Not Available |
| Synonyms
|
- Asparagine-linked glycosylation protein 11 homolog
- Glycolipid 2-alpha-mannosyltransferase
|
| Gene Name
| ALG11 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Mannosyltransferase involved in the last steps of the synthesis of Man5GlcNAc(2)-PP-dolichol core oligosaccharide on the cytoplasmic face of the endoplasmic reticulum. Catalyzes the addition of the 4th and 5th mannose residues to the dolichol-linked oligosaccharide chain.
|
| GO Classification
|
| Biological Process |
| dolichol-linked oligosaccharide biosynthetic process |
| post-translational protein modification |
| protein N-linked glycosylation via asparagine |
| Cellular Component |
| endoplasmic reticulum membrane |
| integral to membrane |
| Molecular Function |
| GDP-Man:Man3GlcNAc2-PP-Dol alpha-1,2-mannosyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | N-Glycan biosynthesis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 13 |
| Locus
| 13q14.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 55650.595 |
| Theoretical pI
| 8.489 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|304434672|ref|NP_001004127.2| GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase [Homo sapiens]
MAAGERSWCLCKLLRFFYSLFFPGLIVCGTLCVCLVIVLWGIRLLLQRKKKLVSTSKNGK
NQMVIAFFHP
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q2TAA5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:32456 |
| References |
|---|
| General References
| Not Available |