| Identification |
|---|
| HMDB Protein ID
| CDBP05155 |
| Secondary Accession Numbers
| Not Available |
| Name
| Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase |
| Description
| Not Available |
| Synonyms
|
- ADPRibase-Mn
- CDP-choline phosphohydrolase
|
| Gene Name
| ADPRM |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress (By similarity).
|
| GO Classification
|
| Molecular Function |
| metal ion binding |
| ADP-ribose diphosphatase activity |
| CDP-glycerol diphosphatase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Glycerophospholipid metabolism | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 17 |
| Locus
| 17p13.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 39529.105 |
| Theoretical pI
| 5.588 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|94158594|ref|NP_064618.3| manganese-dependent ADP-ribose/CDP-alcohol diphosphatase [Homo sapiens]
MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWN
NESSMPCCVL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q3LIE5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:30925 |
| References |
|---|
| General References
| Not Available |