| Identification |
|---|
| HMDB Protein ID
| CDBP05154 |
| Secondary Accession Numbers
| Not Available |
| Name
| Acyl-CoA synthetase short-chain family member 3, mitochondrial |
| Description
| Not Available |
| Synonyms
|
- Acyl-CoA synthetase short-chain family member 3
|
| Gene Name
| ACSS3 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Activates acetate so that it can be used for lipid synthesis or for energy generation (By similarity).
|
| GO Classification
|
| Cellular Component |
| mitochondrion |
| Molecular Function |
| ATP binding |
| acetate-CoA ligase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Mitochondrial Beta-Oxidation of Short Chain Saturated Fatty Acids |    | Not Available | | Short-chain 3-hydroxyacyl-CoA dehydrogenase deficiency (SCHAD) |    | Not Available | | Propanoate Metabolism |    |  | | Malonic Aciduria |    | Not Available | | Methylmalonic Aciduria Due to Cobalamin-Related Disorders |    | Not Available |
|
| Gene Properties |
|---|
| Chromosome Location
| 12 |
| Locus
| 12q21.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 74777.655 |
| Theoretical pI
| 8.638 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|13375727|ref|NP_078836.1| acyl-CoA synthetase short-chain family member 3, mitochondrial precursor [Homo sapiens]
MKPSWLQCRKVTSAGGLGGPLPGSSPARGAGAALRALVVPGPRGGLGGRGCRALSSGSGS
EYKTHFAASV
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H6R3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:24723 |
| References |
|---|
| General References
| Not Available |