| Identification |
| HMDB Protein ID
| CDBP05152 |
| Secondary Accession Numbers
| Not Available |
| Name
| Mycophenolic acid acyl-glucuronide esterase, mitochondrial |
| Description
| Not Available |
| Synonyms
|
- Alpha/beta hydrolase domain-containing protein 10
- Abhydrolase domain-containing protein 10
|
| Gene Name
| ABHD10 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Catalyzes the deglucuronidation of mycophenolic acid acyl-glucuronide, a metabolite of the immunosuppressant drug mycophenolate.
|
| GO Classification
|
| Biological Process |
| glucuronoside catabolic process |
| proteolysis |
| Cellular Component |
| cytosol |
| mitochondrion |
| Molecular Function |
| hydrolase activity, hydrolyzing O-glycosyl compounds |
| serine-type peptidase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 3 |
| Locus
| 3q13.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 33932.165 |
| Theoretical pI
| 8.578 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|8923001|ref|NP_060864.1| mycophenolic acid acyl-glucuronide esterase, mitochondrial isoform 1 precursor [Homo sapiens]
MAVARLAAVAAWVPCRSWGWAAVPFGPHRGLSVLLARIPQRAPRWLPACRQKTSLSFLNR
PDLPNLAYKK
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NUJ1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25656 |
| References |
| General References
| Not Available |