| Identification |
|---|
| HMDB Protein ID
| CDBP05150 |
| Secondary Accession Numbers
| Not Available |
| Name
| 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 |
| Description
| Not Available |
| Synonyms
|
- Abhydrolase domain-containing protein 5
- Lipid droplet-binding protein CGI-58
|
| Gene Name
| ABHD5 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis. May regulate the cellular storage of triacylglycerol through activation of the phospholipase PNPLA2. Involved in keratinocyte differentiation.
|
| GO Classification
|
| Biological Process |
| small molecule metabolic process |
| positive regulation of triglyceride catabolic process |
| fatty acid metabolic process |
| cell differentiation |
| negative regulation of sequestering of triglyceride |
| phosphatidic acid biosynthetic process |
| positive regulation of lipoprotein lipase activity |
| triglyceride catabolic process |
| Cellular Component |
| cytosol |
| lipid particle |
| Molecular Function |
| 1-acylglycerol-3-phosphate O-acyltransferase activity |
| lysophosphatidic acid acyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 3 |
| Locus
| 3p21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 39095.34 |
| Theoretical pI
| 6.615 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|31542303|ref|NP_057090.2| 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 [Homo sapiens]
MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNG
NKIWTLKFSH
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8WTS1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:21396 |
| References |
|---|
| General References
| Not Available |