Identification
HMDB Protein ID CDBP05147
Secondary Accession Numbers Not Available
Name DNA dC->dU-editing enzyme APOBEC-3F
Description Not Available
Synonyms
  1. Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F
Gene Name APOBEC3F
Protein Type Metal Binding
Biological Properties
General Function Not Available
Specific Function Host cellular restriction factor that may have antiviral activities against exogenous and endogenous viruses, as well as retrotransposons. After being packaged into HIV-1 virions, blocks productive infection by massively editing dC residues to dU on the DNA minus strand during reverse transcription. The editing of the minus strand DNA of HIV-1 during reverse transcription leads to G-to-A transitions in the plus strand. The inhibition of viral replication is either due to the degradation of the minus strand before its integration or to the lethality of the hypermutations. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
GO Classification
Biological Process
defense response to virus
DNA demethylation
innate immune response
negative regulation of transposition
base conversion or substitution editing
negative regulation of retroviral genome replication
positive regulation of defense response to virus by host
Cellular Component
cytoplasm
apolipoprotein B mRNA editing enzyme complex
Molecular Function
metal ion binding
cytidine deaminase activity
zinc ion binding
RNA binding
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 22
Locus 22q13.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 11822.52
Theoretical pI 11.133
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|54873619|ref|NP_001006667.1| DNA dC->dU-editing enzyme APOBEC-3F isoform b [Homo sapiens]
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVPR
SFIRAPFQVL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IUX4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17356
References
General References Not Available