Identification
HMDB Protein ID CDBP05143
Secondary Accession Numbers Not Available
Name Probable DNA dC->dU-editing enzyme APOBEC-3A
Description Not Available
Synonyms
  1. Phorbolin-1
Gene Name APOBEC3A
Protein Type Metal Binding
Biological Properties
General Function Not Available
Specific Function Single-stranded DNA cytidine deaminase involved in foreign DNA clearance. May trigger C-to-U hypermutation in exogenous DNA leading to its degradation. Provides cellular innate resistance to a specific panel of genetic invaders including endogenous retroelements and a subset of viruses. May have a preference for cytidines in a C-C sequence context. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
GO Classification
Biological Process
negative regulation of viral genome replication
cellular response to xenobiotic stimulus
clearance of foreign intracellular DNA by conversion of DNA cytidine to uridine
defense response to virus
DNA cytosine deamination
DNA demethylation
innate immune response
negative regulation of transposition
Cellular Component
cytoplasm
nucleus
Molecular Function
metal ion binding
cytidine deaminase activity
zinc ion binding
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 22
Locus 22q13.1-q13.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 23011.83
Theoretical pI 6.843
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|300869638|ref|NP_001180218.1| probable DNA dC->dU-editing enzyme APOBEC-3A [Homo sapiens]
MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAK
NLLCGFYGRH
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P31941
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17343
References
General References Not Available