| Identification |
|---|
| HMDB Protein ID
| CDBP05143 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable DNA dC->dU-editing enzyme APOBEC-3A |
| Description
| Not Available |
| Synonyms
|
- Phorbolin-1
|
| Gene Name
| APOBEC3A |
| Protein Type
| Metal Binding |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Single-stranded DNA cytidine deaminase involved in foreign DNA clearance. May trigger C-to-U hypermutation in exogenous DNA leading to its degradation. Provides cellular innate resistance to a specific panel of genetic invaders including endogenous retroelements and a subset of viruses. May have a preference for cytidines in a C-C sequence context. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
|
| GO Classification
|
| Biological Process |
| negative regulation of viral genome replication |
| cellular response to xenobiotic stimulus |
| clearance of foreign intracellular DNA by conversion of DNA cytidine to uridine |
| defense response to virus |
| DNA cytosine deamination |
| DNA demethylation |
| innate immune response |
| negative regulation of transposition |
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| metal ion binding |
| cytidine deaminase activity |
| zinc ion binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 22 |
| Locus
| 22q13.1-q13.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 23011.83 |
| Theoretical pI
| 6.843 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|300869638|ref|NP_001180218.1| probable DNA dC->dU-editing enzyme APOBEC-3A [Homo sapiens]
MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAK
NLLCGFYGRH
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P31941 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17343 |
| References |
|---|
| General References
| Not Available |