| Identification |
| HMDB Protein ID
| CDBP05022 |
| Secondary Accession Numbers
| Not Available |
| Name
| Peroxisome proliferator-activated receptor |
| Description
| Not Available |
| Synonyms
|
- SubName: Peroxisome proliferator-activated receptor gamma 1
|
| Gene Name
| PPARG |
| Protein Type
| Receptor |
| Biological Properties |
| General Function
| Involved in DNA binding |
| Specific Function
| Not Available |
| GO Classification
|
| Component |
| organelle |
| membrane-bounded organelle |
| intracellular membrane-bounded organelle |
| nucleus |
| Function |
| dna binding |
| ligand-dependent nuclear receptor activity |
| binding |
| receptor activity |
| molecular transducer activity |
| signal transducer activity |
| nucleic acid binding |
| Process |
| biological regulation |
| regulation of biological process |
| regulation of metabolic process |
| regulation of macromolecule metabolic process |
| regulation of gene expression |
| regulation of transcription |
| regulation of transcription, dna-dependent |
|
| Cellular Location
|
- Cytoplasmic
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| Chromosome:3 |
| Locus
| 3p25 |
| SNPs
| PPARG |
| Gene Sequence
|
>123 bp
ATGGTTGACACAGAGATGCCATTCTGGCCCACCAACTTTGGGATCAGCTCCGTGGATCTC
TCCGTAATGGAAGACCACTCCCACTCCTTTGATATCAAGCCCTTCACTACTGTTGACTTC
TCC
|
| Protein Properties |
| Number of Residues
| 41 |
| Molecular Weight
| 4695.2 |
| Theoretical pI
| 3.91 |
| Pfam Domain Function
|
Not Available |
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Peroxisome proliferator-activated receptor
MVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFS
|
| External Links |
| GenBank ID Protein
| 47678891 |
| UniProtKB/Swiss-Prot ID
| Q6L9M1 |
| UniProtKB/Swiss-Prot Entry Name
| Q6L9M1_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AB097931 |
| GeneCard ID
| PPARG |
| GenAtlas ID
| PPARG |
| HGNC ID
| HGNC:9236 |
| References |
| General References
| Not Available |