| Identification |
| HMDB Protein ID
| CDBP04777 |
| Secondary Accession Numbers
| Not Available |
| Name
| Norepinephrine transporter isoform 1 |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| Not Available |
| Protein Type
| Transporter |
| Biological Properties |
| General Function
| Involved in neurotransmitter:sodium symporter activity |
| Specific Function
| Not Available |
| GO Classification
|
| Component |
| membrane part |
| intrinsic to membrane |
| integral to membrane |
| integral to plasma membrane |
| membrane |
| cell part |
| Function |
| neurotransmitter transporter activity |
| neurotransmitter:sodium symporter activity |
| transmembrane transporter activity |
| transporter activity |
| Process |
| establishment of localization |
| transport |
| neurotransmitter transport |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| Not Available |
| Locus
| Not Available |
| SNPs
| Not Available |
| Gene Sequence
|
>129 bp
AAGTTCCTCAGCACGCAGGGCTCTCTTTGGGAGAGACTGGCCTATGGCATCACGCCAGAG
AACGAGCACCACCTGGTGGCTCAGAGGGACATCAGACAGTTCCAGTTGCAACACTGGCTG
GCCATCTGA
|
| Protein Properties |
| Number of Residues
| 42 |
| Molecular Weight
| 5031.7 |
| Theoretical pI
| 7.8 |
| Pfam Domain Function
|
Not Available |
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Norepinephrine transporter isoform 1
KFLSTQGSLWERLAYGITPENEHHLVAQRDIRQFQLQHWLAI
|
| External Links |
| GenBank ID Protein
| 5360689 |
| UniProtKB/Swiss-Prot ID
| Q9UQ04 |
| UniProtKB/Swiss-Prot Entry Name
| Q9UQ04_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AB022846 |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11048 |
| References |
| General References
| Not Available |