| Identification |
| HMDB Protein ID
| CDBP04715 |
| Secondary Accession Numbers
| Not Available |
| Name
| HERV-K_5q33.3 provirus ancestral Pro protein |
| Description
| Not Available |
| Synonyms
|
- HERV-K10 Pro protein
- HERV-K107 Pro protein
- PR
- Protease
- Proteinase
|
| Gene Name
| Not Available |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Involved in nucleic acid binding |
| Specific Function
| Retroviral proteases have roles in processing of the primary translation products and the maturation of the viral particle. Endogenous Pro proteins may have kept, lost or modified their original function during evolution. This endogenous protein has retained most of the characteristics of retroviral proteases |
| GO Classification
|
| Component |
| cell part |
| intracellular |
| Function |
| aspartic-type endopeptidase activity |
| nucleic acid binding |
| peptidase activity |
| peptidase activity, acting on l-amino acid peptides |
| endopeptidase activity |
| binding |
| catalytic activity |
| hydrolase activity |
| Process |
| metabolic process |
| macromolecule metabolic process |
| protein metabolic process |
| proteolysis |
|
| Cellular Location
|
- Cytoplasmic
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| Not Available |
| Locus
| Not Available |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| 156 |
| Molecular Weight
| 17107.6 |
| Theoretical pI
| 5.9 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>HERV-K_5q33.3 provirus ancestral Pro protein
WASQVSENRPVCKAIIQGKQFEGLVDTGADVSIIALNQWPKNWPKQKAVTGLVGIGTASE
VYQSMEILHCLGPDNQESTVQPMITSIPLNLWGRDLLQQWGAEITMPAPLYSPTSQKIMT
KMGYIPGKGLGKNEDGIKVPVEAKINQEREGIGYPF
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P10265 |
| UniProtKB/Swiss-Prot Entry Name
| VPK10_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| Not Available |
| References |
| General References
| Not Available |